S@h`]  .mysect B .intvecs@.text  `]NLB .data@.vars_@.image]_@.bssl]l] .stack4k4k.const4s4s@.cinit8t8t P@.sysmemXwXwGZ@- M k vy} Ѝ@-M2{TQNKHEB?<9*630~-/{*x'u$\ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ ЍFlashWriter Version 1.7a Starting Download to NOR Flash Image is %d bytes long Reading Image from: %08X Writing Image to: %08X Flash not Found or unsupported! Flash AMD DL323 4MB Bottom Flash Fujitsu DL323 4MB Bottom Flash AMD LV160 2MB Bottom Flash AMD LV256M 32MB Flash Intel Burst 8MB Bottom Flash Intel J3 Strata 8 MB Flash Intel J3 Strata 16MB Flash Intel J3 Strata 32 MB Flash Intel K3 Strata 32 MB Flash Intel W18 16MB Bottom Flash Intel W18 16MB Muxed Top Flash Intel L18 16MB Bottom Flash Intel L18 16MB Muxed Top Flash Intel L18 32MB Bottom Flash Intel L18 32MB Muxed Top Flash Intel K18 32 MB Stacked device p@-MDΟ<.<84>@ \PKoDU@@P @@^N>00?0/ :00h?0d/ `\X-^"^"^"^"  O@. ϟ IN"^ ^ +^ 0S00000T>0P. LHD0S0C";852/,)&+ P"\" P \ \ L\ \ \ \ @"\ \ \ W\ \ ~\ XxʟPxʟЍpOSK Micron flash device found Erasing the Flash @-M   HO P* j\:\*ʠ ƠƠ Ƞ LȠ Ƞ t\:{ \*ɠ LǠ Ǡ  \*ʠ ƠƠ \*ɠ ǠǠ Ƞ LȠ Ƞ H|:OȠ LȠ Ƞ :\:A\*ʠ ƠƠ D\*Ƞ LȠ Ƞ :!\*ʠ ƠƠ 0\*Ƞ LȠ Ƞ &A\*ʠ ƠƠ \*Ƞ LȠ Ƞ a\*ʠ ƠƠ \*Ƞ LȠ Ƞ \: ȠȠ Ƞ |: ȠȠ Ƞ |: ȠȠ Ƞ |: ȠȠ Ƞ |: ȠȠ Ƞ |:\*ʠ ƠƠ Ƞ LȠ Ƞ |:\ʠ ƠƠ Ƞ LȠ Ƞ {l|:s\*ɠ ǠǠ Ƞ LȠ Ƞ cT|:[\*ɠ ǠǠ Ƞ ȠȠ K<|:C\\":ɠ ǠǠ Ƞ ȠȠ 2#\ʒ \ \ \ \ \ \/ \; \G \R \^ \ \h \ \ L\    \a:Ѝ@-M  ЍMΟЍ/MΟЍ/@- M@   \  ЍMЍ/MЍ/@- M`@@  @  ^>[P @QP Ѝ@- M`    ,)P  P ЍErased up to address 0x%08X kkkk@- M  ͠=Ɍ ȠȠL\^R L ! P*   P: p   P )%  Q* \   \: Ѝ/ kkj@- M    ?@U0 ,0 ,@0\\" ЍCommand Sequence Error Set Lock-Bit Error Voltage Range Error Clear Lock-Bit Error k@-M   ?AU0 ,0 , A ̌   Ѝ@-M  /AU ̌ \   \c _ P Ѝt4@-(M   LȠ Ƞ  /AU ̌%L P*     P:) \!  \ .  P !  P* P   \:(Ѝ M  /AU  Ѝ/@-DM 0 ^L \K P  P:  @L@@P *@@@@P:@ @ e@@@@ PL& \DЍM Ÿ ȠLL|Ltl`"\ R  R  3"@LL UUЍ/@-Mx@ d   \Q  0pAЍWriting the Flash Flashed 0x%08X bytes of 0x%08X total bytes No Flash devices have been found Flash writing completed!  pxdH4kO- Mp` D@PP Tl*PPP @m%\WV rLP P Pl\@ ̌ n\ s\ ϟ@5 @/ ϟ@) 0 \     \:\ Ѝ  \ \ \ \ \ /p@- M`@P*\  0\ :\0\P \Zl.\)*\  } 0\ :\0\\  ЍpO-p$@Y3 PUJ U: P`V` ! pUϰ F 3 Fp  pUϰ F $  Jx EC-MP|l pqF̌@@ . L@ d\  %\ \ \ \ \ 'eL\\ L\\ \ w  0(  0o @\ u\ o\ x\ X\\Y L+L-  @ ϰ FqĽ\L Lr > PL G  @  H0}  X0 H m ЍC-pL`@LϏ  @@TQ% E\ \ \ \ \ 0 0 0((null)p@-M`@ R C E 0\ `0  PZ \P  0+ލp%p@-tM`P\CE@/ / %.  /  @D/ / -  @6. J/  0G \  L @ L  `0  V@ \@  0tЍpp@-tMP@` R RZ   0 |0\\\`L L  x0`P  V 0tЍpG-p P `LX @ WZ L0@T WWJ @Z \ `v0QLP`F\@V\WZ@gT d PLVPTph@WZ0 @ \?$@p@-@`PUe d 0 U u@0U-CJ+@L`pA-`P@pT TpLU L.0PLP@D TT W :G@W\LPA-P@\USUCE` X\ \ \ \ ppp6 1 dR iRPCE`B E0a`0L` V x\ X\   @ L o\L p\1 . R R X\( \& \$ \" \ \"X\ \ \ \ \ \X\ \ \ \ \ \\// k@-@p`PL0  EXW A T PG @$k@-Q \   0123456789abcdef0123456789ABCDEFe@-ş@ şPP(%P|ş@ 0@-P\ PE(@Hş T0 P0p@- M`: @ PDD\P P ЍpA-`pPğ@ D(@|ğ Ttğ@ \ e PP庀 p` $ ($ğ@ 0@-Pß@ P PPß@ 0ß@ 0A-MPjtß@ ß``Vdß@| !Q F́ pϰ @j P JpPŸ@_ PŸ@Y Ѝ@-`PpJWPŸ@J Ÿ\  @@ PP\Ÿ@: @-`PpJWP Ÿ@, Ÿ\  @" PP@ @-`PpJWP@ \  @ PPl@ p@-P JU ,@ @Q\$@ p@ `v @ p0@-M@ @ P@ Ѝ00@-MP@ @ TP$@ P(@ Ѝ0 k8ih8iHhh$k hh@-ş 0@T:R Q`ş QR / Q/@-ş@p ş@ğ@d p@-`P ğ@[ ğPPUğ@R p\: 0C\:L`Lğ@; p@- !  QA-pPG`XM9ß@ @ϰ0 @DV> V0:ß P* L0JyS035':PCRP  Ÿ@Ÿ@D\:PLŸ@p@-`R xŸ@pR`FU*0 PU:0U<9  @Ÿ L T@ϰ0ϰ@ST@p T   D@ypG-pGQ* W @g@T  `D LP0F0`PE\UZ@TTx@Fp V CU5 05 E"%+@/,k kXw(k$kTw@-Pp`ğ@ DPEĠp'Ġ&0  Ā hFhtğ@VAQ0@-PHğ@@DPEĠ 0 Ā XEXğ@0@-Pp`ß@ U\C`FĠP%Ġ 0 Ā XEXxß@@-Pp`Lß@ U\ @D6RS:0S ^ p 0 ^*^: pn1 N pn1@D@|p@|{T*a  0@-Q@[@0G-`@bPH  P@Wp \1 W@  W\   P   @ + @pGPU Y P PL WW P PZˌPpW aR/@-+/R:- BPP R*  0 O00PP R0O0000000000 R  R:00#80@ R*r 0 0  B" 0$0$ R :00#40@#40@#40@ R* 00 RA-0CSUZepzQW1 %*5@J!T& @fpeppCS@BJ|p@T{T*   @-`@pP|% T V! \ Ln T@ VpV``WP L jC@-|   @@Q <@T0@-@|  0  ?P @ P `B1a 1 R( R$R RR RR RRP0@ P0@ P0@ P0@ P0@ P0@ P0@ P0@ Q"$1:cB`" @-PPPڸ@` p|  P@`PP@-@p    L)PEˌCCJ@ 0dap@-@MPU a@6EPU@T?@T;0@-PT@4L PL@-0,Q$@#0 k jjjj$k@- / R( R$R RR RR RRP@ P@ P@ P@ P@ P@ P@ P@ Q"$1:)ПЍp Pu @T~ RJ00 RZ  00 R  b R4k8t0@-M@PP  \ P \  U&P P  UpˌЍ0a@-PQ^^^R JPHP1JQSPXR1JSQ@-0@@\S 0S@-@ 0  RQ \   \l]x]@- R RRR:R :R:-@0B P0S@@-@Pj u P  L" pV c@-M0@P@CP`   0l  T-l M@  DЍ@-l 10@ 00-Q +Q00^`4sp@-`P@| V E P  kppp-@-pM< | 00Ѝ@Ѝ/aX[\[@-N^CH~ %!2. ^21.1PbBQP@RR @0AQR B R/ R/P`BQ C S@: !R @\  R/S\ 0S/@\ \//// k$k BR P //@/ GF @A\/@Q/ ]` @ﾭ]  )lO0P 8 80 C P\@@ @dh P #   MMOР iHM (B B H4P $MMOР iHMT!(B B H4P MMOР iHM!(B B H4P MMOР iHM"(B B H4P DMMOР iHMt"(B B H4P MMOР iHM"(B B H4P ~MMOР iHM4#(B B H4P ]0000 D@dTD@8 R  R\  1Q88!Ph X1 PH 008, R3 P P0PHD< @$H4UU <`pxh00(0!1UA1_- a4! p@-M@ 1,0<8 40P@`'($ 0& 0&R  0&UnPNPz Z c0C0vV`&@TT 01 @ 400&Ѝp   $ T  )    @-@&@ @-@&@ @-@&@ @-@&@ @-@&@| @-@&|@s @-@&s@j  0 - 0? 0+@-@3d0] P@- :p #C2d111Bc#C2`111Bc40##I 0S@!;P(MbC0 0 0 ] ] <<004 Sa050%000 0C200] ] P@- :X #C2d111Bc#C2`111Bc0##IP(MbC-(0- 00 `0] ] ] 0000 R100R ] ] ] @-@M @ 84$0S @100@Ѝ -,,%(0$0 0 0%$ < DHL, @-0%0@ %0 /X l I @-@% @ / I p@-Q0C$HDM$ M0$0H0$ G0L1LA 0 c<1Q  PO0S>@s*@@@ #P@P0T0  `0TP 0S@@UO&5+%=7l#P X#P  s0@0<y#P0 ]DHpP ]    P  ^ -&% @-qPM!0P @0<`0@/00! /  0Q0ڌ00 00 Rt0 l@0Sd$ P0 H00  0/`Ѝ^ P ^ ^ p} ] t} ]  @-h00S`T0P 0cSD@00S40ڿ$00@@p}    D-t0cl3 p `3 \3\ß X3  M`D3 RQ$3 0b03P [/00VBD\DDD\  I/"2 2 2 2V Vt p2<2 TP2 0,2 $ 2 2 1P P(aV!1 1C1 l |1 b!h$= \1 .$PHQ@30S (1 $10bP0@ࠁ0S Sg S PQ  #  11 "0 )1  @! Ѝ__ x} p} t} |} ^ ^ } } ^ ^ ^ 4 ] @ ] H P P P X ^   d ^ d} h} l} l   P   0 ^ 0@-d!PPX -@LT@@-T ,0 0  0@   ^ '0`} @-@T0  0 0@d} h} l} ~ N-QPP4u``M$ (X.P+p(0@0P0`@ 0 & 00c . 00c 0000 |0@+@ 0` . ЍP ^ ^ |} p} x} }   N-(5$5 QM@e? 55,48 < .$s(,#Ƞ4!Xr"Uʴ!"48<#Xp@D Up@DT"8:#:S "4880E 0 0@@G0#50@0ˌ0 @|g)Ѝ@]^ ܃ ^ ] ^ ̃ ! ! " " ] 0" x^ L" \"  P   |&# ȃ    z^ @-CRDQ@M@S@ 0BRSR@0S@ 0S@ =)0 0S@Ѝ 0@-@MP |,) ()0Sl@ T!)P0 D)q(P0 h$0SZЍ0^ ^ ^ z^ ^  R@-0@1D t" -,00S$$qf ! *@-c@}S59R@   <6 4 <("4  !ڍ$ @-M@$P  `1%<4<,4%<  `0@0` 1 %0/"?0 p`0g C1ڍ p@-MP @| `%<,4<$, `!4%< $`0$,0` 00m C1ڍp$ |000CS0;<;H;T;X;d;x;LD"<0?g00(0$0uX   P  @-M@ $<4(<"4 !<S0S 0S0S d0T \0T<4(<"4< <4(<"4 !<0ۍ H L 0@-M  }$<4(<"4t !<S P0S 0S 0S @T(  0\$ ۍ0   @-M  O$<4(<"4` !<S0S  0S @T( 0@$ ۍ   0@-M  &$<4(<"4h !<S P0S  0S 0S@T $ ۍ0 $ D-0M #<4(<"4 !<S 0S 0S0SpW $ <ˍ4<("4/P!\p`  h"'#@  #0@0p  #0pۍ  `# 0@-PMd #<4(<"40! !<SE R  0S0S0S R0S 20,$,!$#,b)@Q 0?8c13Q 0?5c1R# `d <4<("4!L d Pc#0 0SP5ۍ0 P d! gfffP ^ 0@-x! Q 0hQ00CSSAAAABB@B40D${1P09P@ V0R000P I#0000+ P@0 0 JPT 0000S0000@0P X d# ^ # \! # P  #   - 0 # ^ F-(("(r0$bRM0 2 ЍFQ0S1  Ġ8̌#Č"̌,4, ,̠0+%!:!P@ '@00!8ANL00X004Q_$a$Z0S 1P 0 0R I@ Q !0 00Ϡ0 >"ЍFi^  D  ^ # ^ ^ $ \ !  ,$ ] " ] 0" x^ P$ \"  P d$ B'@AX P T z^  0 QP 0 000  @-0@pt 2dA00`0A0ABdP`@P@#*$00 T 0` p@-L`LP@9@ 040@@00$ 0<0000p ,0 $0 0  0  @008 00000$ 0<0 0<0 1p@-<QP{T00(T  R 6$0`V01 .}T)T- 0iC R 0 R00@TP`T 00`X@T`@<0PPP@, 0 褎 +  ( @-@% R@-@p`D0@PU  PP`UP D-Pa`@ 3< 4( <"4,<@@ S p(L D8 L#D,Lpg0S@ <4(<"4!Ll,  S<4<("4!<\4 $褎 , V'4, L, X) d, ) N-0MP0 H1RF 1 PU= <4<,4a.< S@ p.L D8 L#D@ ,Lp 0S- LD8L#D"L  <4<("4!<PPLH0Y0Q0S0 ZЍ脠 V' - X) d, ) p@- @ B 8#" 8 #" , $8  ,#$ ,,.x0Sph{@P`~D0,$,,$#L( `Pp4. L. `. I . . . -0MS (f`f0f`f`f8f`f`f`f`f`f`f`f`f@f`fHfPfXf! ! !!!!!!0S*ffffffffffggg gg40,($    0SPgXg`ghgpgxgg0 0 000000P PPЍ. . . . / /  / /  / ,/ 4/ 8/ D/ L/ T/ `/ h/ t/ |/ / / / / / / ) / ) / 0 0 0 (0 80 L0 `0 0HoN-@ R4Mp P   0 4 P 00SP 00SP0PU0 00 $00 P `p 0 0e   AP<r 00i0  4Ѝp0 0 \hph0 0 @-0@\褎 0 p@-MR`!= R.0S0.I.OP`<@T01SLL04 @T `,@-VЍp41 P1  d1  0Q 0@n (2Z$ W 0Ub0" 0PY  0#PP" @ 1 cL 1301l1Z L0 + 0P7 0T!00P.V:8P)  AP@.0Z  0$%RdR1 0 0U 0 0 00P  ` V :X  Ѝ ) 2 h  1 1 3  1 L3 2 1 % 0@-0M P0 P00R00S@ 0 R R R0b T0QPD0U@ 8 P( @Ѝ0脠  1 3 h3 @-0*S@     1@0*S  @-@p`P@ R !MW,v0n`pp@PP*41Z40U 1 0010s0d0P0@`P >0>0@0b@p0e 0 Z0 00P W00 0Gp 0 W 00=@ 800Q0000 0S0HQ  XU   Џ  PF- Ppp~W*l4Q ^ ^ 0  0 @0P0 @P+$Q R'38PR[PTR'6nP UR7wP3R'9|PPE~P3A ^ 0 gQQ QPd ^W 0 gQ  0P 0 Q  0P00 R *JA 0  - P"38P[ TP"6nUP7wp2P"9|~XbA\0  10 00R*\ 00R: @ @ !?#?C1 P80PP ` @ ^ 0 gQ:Q FQP@00L`F0 0 S 10PP P @000gQ)000gQ!P' 00P0 @ 0 @ P  000P  00 PHQ TPQ PD-P@0@` V0S@P`P @0010TP81DSp P` 0R   @p00W@  ,1Rp PP  P 0W0@ T10055: Q$38Q[ TQ$6nUQ7w0Q$9|~\0! 10 00T*\ 00T:  PPHQ PU  PQ TN-QpMPЍNB@@ 0S` Z P 00000P 0R0k0 000 0 0 R ` 00 `c0P Q <0P0< 000PF  J$R@ 0PR000R 0 0000#R0000 0000000k0 000 00D2 \   0 J @$R ` 0 V. P+  J 0@$R`PR000R 0 0000#R0000 00000051PPF 000@@T00` @"  J$RR000R00000#R0000000000kQ0P 0 0 0  000i000 000ЍHQ QD-PPD* UPP!Pp|P`G 0 e0C0@C0f S@f  a00 0000000*`000jS0 000 00  @-0p@0`TPP@  R00Q00S  B$RR 00R000#R000000HQ p@-`0 @0`>0>0ZC U$0 0Re 0erd @`T 8000c( 0000e0pHQ  XU P @00@ 0 CP,$ 8040(0Q0PU  TU  @-0@ XV -0S07`U 0S00`U 0S00`U 0@-%lPl l0 @TX (B< Q00T0000XV \U I `U 0@-@@<  0P$0 000 0XV `U @-0P@p0P `0S0D0S`0;(P p00 k0\V XV J (J t< 0 0(XV \V -8  L01 Q 80040 0,0 $0$0 ,00 (0Ժغ8  N-P `@0E8pUL#R0#03^0S 0R P00Q!3\\ 8C\ !0 00CP ! 0Q :   0 \<<0 R P:000CP ᄠ N-0M0C 0`p VV PYR Y P-@  0D8#8P08CP 0 0 W0#03Q030"S 00S'PQ^ P U0V0 Y00S P 00@gT@!  02Q^P Pp`V00 U00SЍP- P P P P  P P @P P T P LHD@<80,, @J \J pJ J J J K K @K HK p@-`P@T V00U0S P` pP@-@@p@-`VP@ PbT00P0SpT f~pQ0@-@P 0 d0 ? 2cR@@ 0 d0\ ? 2cR@d@d 0 0P  00 00Q@-@ P 40000 0@ 00 00TSIL0 00F-P@ Tp@ T 0Sg PtU@ @T Y  0# 0# 0 0C`D !d""Y  0# 0#  000r@-@ R0 0L!!@q Q0 0A# 00N-PMP`0 0SPPP P R  P@P0DpP Pa$0<HT`p000 00 00C00C0 0C000 P7$$$$ZP@C00 0pPOP@804 0pPDP@-0P400p9P@"0 4pP0 +0P@pP0 0ZP@0 0R Ѝ0 @0 Sa@QA0@W @S7 @ 0@-@PP0P020Q 0 P:QQ1121:QQ1101:P@  !P@ !!P!@ #!!P@ !!P#2!-1Q) QP10QQ1121:QQ1101: P@ P@ !!P!@ c!!P@ !!P#2!" l!-@-p(%R-+00 0!0 "0 0!0 "0 0!0 "0 0!0 "0 0!0 "0 0!0 "0 0!0 "0 01N^ #^ 0 0 01^ # - $ < PD-FK3p`Mk3Q0cP1I@ TP @D({Tw  Dr`K hK pK R@-`P  \\p P @ \ 00  @\ R `Y  000S Br 000S 0S  0S000SR 0S 0S000S  R  000S  00c̰0R @ R-0 0 0c0\  R @ 0S  P0S0@-@P 0R0@P3080S  0SbAq 0S Aq 0SbP0@-P GP@0f0-0S R 0S  R0S 0S0S R 0S R0S0@-@PPd0@T 0 R@0  P 0S000 0ԏ 0@-@PT  P00 0P 0S0S0Q 0 A0S Br0 Br Br 0 Br0 Br0 Br0P0B s 0 Br0s 0q Br0lR  0 R\R0S R@-PpP`P@  P@D TPB| @ 0RL|@-00S@ 0xS0t 0D^^ H0 D00L  0L070C70LS1!02:TY -0-S  `-000C S0!00C S0AN-XM|$Ÿ$@ P0I"S`pxx 0  W-0 0pg+  PE  YPE YPEW000  ; @0 X0PpD C [ PkUPEU 00PE Q R Y00 Y000!00UPEUPE [K [000K\LX D Q\ LAUPEU 00PEXЍxK K F- M0S`@/ %Q$0  0 0CS$<<,<<<<<<<<<<4 00A Sp%p*Q00pW`pg 0.S 00B S *R00\0 lRhR qR0000%0C SS񟗧xXpGWpG 0W00pGW0`apG 0W0[P1UP J`WpGW 00pGP 0 R0WpG?W 00pG9wp0 m`,0 i` '%00$ @ %000 R 0C0lQ` hQ0 `S8`C0>@0  0S0i0 ЍK --  Ѝ-- = 0aЍ᠆@-PM0 @\ @@@ 0S00000Ѝ@-P@M  R $0S 0S ( $00ЍP@-P` (  P pp0 pV 0`f 00FS0`@ 0 S8&~P P0@-@P 0S 0Sp0x R 0 B0 0  Q000 30 #20S00"0    R 0 B0 0  000  2x2# c0#22cQ00T2 w000 6U 0S0S 0f| 00 0]\g   0S0000 RT 0 B0 0<00 0 RC 0 B0 0800 0 R1 0 B0 0400 0 R 0 B0 000  R 00t0 000100000U 0 00 000L 8L LL BdL |L  0SPp@-`  Rp0S00 00\pQ@ Q0SS Ra\00Q00S0 d0Q0p@P^ 0@P0pp@-80S<00@00CS` ( !ࠑ$0S 8(0P\00P P$P40   <00SppD-`p(@  P@ ( PP0@ <(P($,0080 N-400U *PU*0 R cPU:050p( 5 P \p 0 0  Q| 0 < 0a 4S0!0SP0P L00SD 000000S$80848888,88f'  20 4 0040040030   0000>00 0<006:0t p l0 40`0 00T P L0:0@ <0:00:00700p000000000=00800<00=000      x010070p0:0tt00 $(,048@DHLd`   0<04p@-`VlPTLH0<@ P0 B `q 0lp脠 M ]  |0RD-"88Sp RR1@<080gX   ` PP 0@-0 RP0@8"88S20~S S* !%#0@T0?0c1Tp l0 d0\\ \   0@T@01 N  N N 0N DN XN xN gfffN N N N I p@-D1U <1 M` @000,S S 1 00 0760000 0R R 0R000004000000400~00d0040\<00@PQ< P ЍpTU N N O P00`0000000D-Q00á?@`p T1QPP|!88S 8uTP  !00PSUQ c`CTP- 00S%1 @PP00 00000|0Pt>00000 P0000</PU HO TO lO O I O N# O F-\pP` R7 Q048P#0U0P00S PU 00$P00(S"PU048PU# !$(,"( IP@`U:048P#Z!$(,"( 3P@ Z`PENU*UQPU 00$P00(S"P048P#!$(,"( F0(0@-"X"U@ d 0n@00P;0 B00P00ā00 000O N@-,@,0 (j00S000耠 Z P M000cS0000cSЍ-0?:0?0?-&N@-@J@@-@J@- N-M 0X08@TH0,$,!$#<[0Pe 9p@ <4(<"4!!<S   0L D L8 @P#D ,L P ` p  0% <4(<"4< R!\@` $ <4<("4!<P   0u0 4S   0g 0S0S   1S2CcTE00Ѝ+  P V',) @) X) t) ) 

jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z- IRQs %s FIQs %s Mode %s%s Resetting CPU ... USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32UK10_32UND_32UK12_32UK13_32UK14_32SYS_32pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%coffundefined instruction software interrupt prefetch abort data abort not used fast interrupt request interrupt request baudrate %s U-Boot code: %08lX -> %08lX BSS: -> %08lX RAM Configuration: Bank #%d: %08lx Flash: ipaddrethaddrloadaddrbootfile### ERROR ### Please RESET the board ### ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again gatewayipnetmaskvlannvlanserverip Abort Bytes transferred = %ld (%lx hex) %lxfilesize%lXfileaddrnetretrynooncebad length %d < %d invalid RARP header len bad %d < %d checksum bad ICMP Host Redirect to *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: `ethaddr' not set %d.%d.%d.%dnone%dLoad address: 0x%lx Loading: *octettimeoutFile too largeFile has bad magic %lu MB reveived TFTP error: First block is not block 1 (%ld) Starting again done TFTP error: '%s' (%d) Starting again T Retry count exceeded; starting again %02lX%02lX%02lX%02lX.img*** Warning: no boot file name; using '%s' TFTP from server ; our IP address is ; sending through gateway Filename '%s'. Size is 0x%x Bytes = *** WARNING: %s is too long (%d - max: %d) - truncated BOOTP broadcast %d Host NameRoot Path*** Unhandled DHCP Option in OFFER/ACK: %d DHCP client bound to address autoloadNFSDHCP: INVALID STATE RARP broadcast %d /*** ERROR: Cannot mount *** ERROR: Cannot umount *** ERROR: File lookup fail *** ERROR: Symlink fail Timeout *** ERROR: Fail allocate memory /nfsroot/%02lX%02lX%02lX%02lX.imgFile transfer via NFS from server Filename '%s/%s'. Load address: 0x%lx Loading: *%s: Far too big packet error. LAN91C96%s: Memory allocation failed. Failed to initialize ethernetchip bootdelaybootcmdHit any key to stop autoboot: %2d %2d OMAP5912 OSK # ** Too many args (max. %d) ** ## Command too long! Unknown command '%s' - try 'help' Usage: %s 'bootd' recursion detected ## Error: "%s" not defined verifyBad magic number Bad header crc Bad data crc Bad image type Empty Script ## Executing script at %08lx autoscrautoscr - run script from memory [addr] - run script starting at addr - A valid autoscr header must be present arch_numberenv_tboot_paramsDRAM bank-> start-> sizeethaddr =%c%02X ip_addr = baudrate = %d bps %-12s= 0x%08lX bdinfobdinfo - print Board Info structure ## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX gogo - start application at address 'addr' addr [arg ...] - start application at address 'addr' passing 'arg' as arguments resetreset - Perform RESET of the CPU ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... ## Booting image at %08lx ... Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC OK Unsupported Architecture 0x%x Standalone ApplicationKernel ImageMulti-File ImageWrong Image Type for %s command XIP %s ... Uncompressing %s ... GUNZIP ERROR - must RESET board to recover Unimplemented compression type %d autostartCan't boot image type %d bootmbootm - boot application image from memory [addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image bootargsboot - boot default, i.e., run 'bootcmd' bootdbootd - boot default, i.e., run 'bootcmd' ## Checking Image at %08lx ... Bad Magic Number Bad Header Checksum Bad Data CRC iminfoiminfo - print header information for application image addr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums) Image at %08lX: imlsimls - list all images found in flash - Prints information about all images found at sector boundaries in flash. Image Name: %.*s Image Type: Data Size: %d Bytes = Load Address: %08x Entry Point: %08x Contents: Image %d: %8ld Bytes = Invalid OSNetBSDLinuxVxWorksQNXU-BootRTEMSUnknown OSInvalid CPUAlphaARMIntel x86IA64MIPSMIPS 64 BitPowerPCIBM S390SuperHSPARCSPARC 64 BitM68KMicroblazeUnknown ArchitectureInvalid ImageStandalone ProgramRAMDisk ImageFirmwareScriptUnknown Imagegzip compresseduncompressedbzip2 compressedunknown compression%s %s %s (%s)Error: Bad gzipped data Error: gunzip out of data in header Error: inflateInit2() returned %d Error: inflate() returned %d ## Transferring control to RTEMS (at address %08lx) ... List of available devices: %-8s %08x %c%c%c %s coninfoconinfo - print console devices and informations Un-%sProtect Flash Bank # %ld %sProtect Flash Sectors %d-%d in Bank # %d missing or unknown FLASH type Error: end address not on sector boundary Error: end sector precedes start sector Error: cannot span across banks when they are mapped in reverse order Bank # %ld: Only FLASH Banks # 1 ... # %d supported allErase Flash Bank # %ld Bad sector specification Erase Flash Sectors %d-%d in Bank # %d bankErased %d sectors Error: start and/or end address not on sector boundary %sProtected %d sectors flinfoflinfo - print FLASH memory information - print information for all FLASH memory banks flinfo N - print information for FLASH memory bank # N eraseerase - erase FLASH memory start end - erase FLASH from addr 'start' to addr 'end' erase N:SF[-SL] - erase sectors SF-SL in FLASH bank # N erase bank N - erase FLASH bank # N erase all - erase all FLASH banks protectprotect - enable or disable FLASH write protection on start end - protect FLASH from addr 'start' to addr 'end' protect on N:SF[-SL] - protect sectors SF-SL in FLASH bank # N protect on bank N - protect FLASH bank # N protect on all - protect all FLASH banks protect off start end - make FLASH from addr 'start' to addr 'end' writable protect off N:SF[-SL] - make sectors SF-SL writable in FLASH bank # N protect off bank N - make FLASH bank # N writable protect off all - make all FLASH banks writable -lt<-gt>-eq==-ne!=<>-ge>=-le<=Unknown operator '%s' Invalid data width specifier itestitest - return true/false on integer compare [.b, .w, .l, .s] [*]value1 [*]value2 loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes ## Switch baudrate to %d bps and press ENTER ... ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... ## Total Size = 0x%08x = %d Bytes %Xloadsloads - load S-Record file over serial line [ off ] - load S-Record file over serial line with offset 'off' loadbloadb - load binary file over serial line (kermit mode) [ off ] [ baud ] - load binary file over serial line with offset 'off' and baudrate 'baud' Total of %ld %s%s were the same %08lx: %08x %04x %02x %cbyte at 0x%08lx (0x%02x) != byte at 0x%08lx (0x%02x) word at 0x%08lx (0x%08lx) != word at 0x%08lx (0x%08lx) halfword at 0x%08lx (0x%04x) != halfword at 0x%08lx (0x%04x) bytehalfwordZero length ??? Copy to Flash... done Base Address: 0x%08lx Pattern %08lX Writing...%12sReading... Mem error @ 0x%08X: found %08lX, expected %08lX ? CRC32 for %08lx ... %08lx ==> %08lx mdmd - memory display [.b, .w, .l] address [# of objects] - memory display mmmm - memory modify (auto-incrementing) [.b, .w, .l] address - memory modify, auto increment address nmnm - memory modify (constant address) [.b, .w, .l] address - memory modify, read and keep address mwmw - memory write (fill) [.b, .w, .l] address value [count] - write memory cpcp - memory copy [.b, .w, .l] source target count - copy memory cmpcmp - memory compare [.b, .w, .l] addr1 addr2 count - compare memory crc32crc32 - checksum calculation address count [addr] - compute CRC32 checksum [save at addr] basebase - print or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off' looploop - infinite loop on address range [.b, .w, .l] address number_of_objects - loop on a set of addresses mtestmtest - simple RAM test [start [end [pattern]]] - simple RAM read/write test sleepsleep - delay execution for some time N - delay execution for N seconds (N is _decimal_ !!!) bootpbootp - boot image via network using BootP/TFTP protocol [loadAddress] [bootfilename] tftpboottftpboot- boot image via network using TFTP protocol rarpbootrarpboot- boot image via network using RARP/TFTP protocol dhcpdhcp - invoke DHCP client to obtain IP/boot params nfsnfs - boot image via network using NFS protocol [loadAddress] [host ip addr:bootfilename] hostnamerootpathdnsipdomainyesAutomatic boot of image at addr 0x%08lX ... Environment size: %d/%d bytes ** Abort stdinstdoutstderrCan't delete "%s" ## Baudrate %d bps not supported ## Error: environment overflow, "%s" deleted setenvSaving Environment to %s... printenvprintenv- print environment variables - print values of all environment variables printenv name ... - print value of environment variable 'name' setenv - set environment variables name value ... - set environment variable 'name' to 'value ...' setenv name - delete environment variable 'name' saveenvsaveenv - save environment variables to persistent storage runrun - run commands in an environment variable var [...] - run the commands in the environment variable(s) 'var' %s versionversion - print monitor version echoecho - echo args to console [args..] - echo args to console; \c suppresses newline Unknown command '%s' - try 'help' without arguments for list of all known commands - No help available. helphelp - print online help [command ...] - show help information (for 'command') 'help' prints online help for the monitor commands. Without arguments, it prints a short usage message for all commands. To get detailed help information for specific commands you can type 'help' with one or more command names as arguments. ?? - alias for 'help' In: No input devices available! %s Out: No output devices available! Err: No error devices available! serialCannot initialize the list of devices! *** Warning - bad CRC, using default environment FlashErasing Flash...Writing to Flash... Timeout writing to Flash Flash not Erased Can't write to protected Flash sectors Outside available Flash Start and/or end address not on sector boundary Unknown Vendor of Flash Unknown Type of Flash General Flash Programming Error flash.c%s[%d] FIXME: rc=%d %2ld.%ld %cB%s0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzfile errorstream errordata errorinsufficient memorybuffer errorunknown compression methodinvalid window sizeinvalid reserved bitincorrect header checkincorrect data checkinvalid stored block lengthsinvalid block typetoo many length or distance symbolsinvalid bit length repeatoversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeinvalid literal/length codeinvalid distance code0.95Pstream endconfigured too many flash banks! INTEL Unknown Vendor FLASH 28F128J3A FLASH 28F256L18T Unknown Chip Type Size: %ld MB in %d Sectors Sector Start Addresses: (RO) %08lX%sIntel StrataFlash 28F256K3C device initialized Micron StrataFlash MT28F128J3 device initialized ** ERROR: sector count %d > max (%d) ** - missing - no sectors to erase Can't erase unknown flash type %08lx - aborted - Warning: %d protected sectors will not be erased! Erasing sector %2d ... done not erased at %08lx (%x) %c## Loading Ramdisk Image at %08lx ... No Linux ARM Ramdisk Image Starting kernel ... $ x X  8L$  t b  t7 x7 |7 7 7 7 7 7 7 7 7 7 7 @C C D HQ HQ PQ PQ XQ XQ `Q `Q hQ hQ pQ pQ xQ xQ Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q R R R R R R R R  R  R (R (R 0R 0R 8R 8R @R @R HR HR PR PR XR XR `R `R hR hR pR pR xR xR R R R R R R R R R R R R R R R R R R R R R R R R R R R R R R R R S S S S S S S S  S  S (S (S 0S 0S 8S 8S @S @S HS HS PS PS XS XS `S `S hS hS pS pS xS xS S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S T T T T T T T T  T  T (T (T 0T 0T 8T 8T @T @T HT HT PT PT XT XT `T `T hT hT pT pT xT xT T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T U U U U U U U U  U  U (U (U 0U 0U 8U 8U @U @U bootargs=mem=32M console=ttyS0,115200n8 noinitrd root=/dev/nfs rw nfsroot=157.87.82.48: /home/mwd/myfs/target ip=dhcpbootdelay=3baudrate=115200ipaddr=156.117.97.156serverip=156.117.97.139netmask=255.255.254.0bootfile="uImage" J ??      #+3;CScs !1Aa  0@` M M  K K K K  L  (((((AAAAAABBBBBB\/-x& tY& & ' Y' ( Z( 8( ( T ( * ([* * B 8a+ + 8a+ x, \a, , - c- - h1 jp1  3 n3 3 \4 nd4 4 L5 \qT5 5 7 w7 8 : x: L: : {: : ,= 0= L= = = = >  > 0> t> Lx> > > Ћ> >  ? $$? @? x? ? ? ? ? @ @ \@ @ A p A (A dA ȑlA A A DA B 8B PDB B |B \B B B hB I C tC  ??h h h h8i jjjXw(k k\$k\k,kXw0k$,8DPp| $00TT`t:T4 L d !8!6h"8"60#:@#:d#2#8#1#8##7#8$8$9 &3H&8h&8&8&;'5'9':D(;T(;d(;t(;(/(;(;(<(;(5)9$):h):)4)9*:*:$+:<+:+:,:(-:/!(0:40"`00001D1kl1j1112,21t222223`33334 4X44444585X5l555556D6T6d6!h6l6p6t6x6|6"66H7x77788X9Sl9999:$;l;;L<X<R\<!`<d<Rh<"l<<<:<<<=4=@=`===== >D>P>p>>>>?0?ZOZYD[$X[%\[&`['d[h[\\h]_  N ^ ,4<HT d tx #$w  (8@PX\dp !"%'(  (4@LT\l |"$%&(*,-/2 4(5098;@<X>x@BCDE  $ 0 < H\     $0<LLXdht"&'     48DP h"l&t'|-/1340 ,<Tl!#&()+.013 6(70:<<H=`?dBlCtI|KLNPRSTUd  4 DDxLdlt| !"#$',)@*L+d,x-.02468   ,!8"H#P$X%&'()*+,./12367:,;<<H=TA\d|   kg6.bfe.efe  Pt.bf e$_size _srcAddr + _size _srcAddr 5 .ef\e+?6.bfe.efeR\ x(u=.bf\e-=e  o  L1lL2xL3L4L5L6L7L8L9L10L11L12L13L14L15L16 L17,L188L19L20.efeeSL1SL2SL3SL4(SL5DSL6`SL7SL8SL9SL10SL11SL12SL130SL14LSL15lSL16SL17SL18SL19SL20 SL21,SL22Ly6Y.bfeY.efet*u.bfreU$_addr _addr   _manf _code _code1 _code2 _fladdr L21L22<L23pL24L25L26(L274L28PL29L30L31L32L33L34L35 L36L37$L388L39DL40PL41\L42hL43tL44L45L46L47L48L49L50L51LL52lL53p.efxe-SL23xSL246.bfe.efe$w.bfe? _sa _bc   _sa _bc   _addr  _range   L54L55 L56 L57 L58D L59\ L60h L61| L62 L63 L64 L65 L66 L67, L68P L69d L70 L71 L72 L73 L74, L75T L76| L77 L78 L79 L80 L81 L82 L830 L84T L85h L86 L87 L88 L89 L90 L91 L92$ L938 L94d L95| L96 L97 L98 L99 L100 L101 L102$L103<L104HL105\L106L107L108L109L110<L111hL112l.efte`6.bfe.efe t P4{.bftel_address _address L113.efeu%7.bfe.efe6 8d{.bfeG T .efea 7.bfe.efes 8{.bfe  .ef4e7$.bfe$.efe4${8.bf4e8 _ulData  _ulData  L114dL115L116L117.efe7>.bfe>.efe 4|H.bfeH_addr _addr .efe7N.bfeN.efe, B|X.bfeX_addr _addr .ef eB"7^.bfe^.efeV $Z|q.bf eqj u _retval  L118TL119L120L121L122.efe9(7w.bfew.efe$|.bfeJ  _retval  L123L124\L125dL126pL127.efeqSL25CON1CON2CON3CON4CON5.7.bfe.efe$V}.bfe!$ _ulData  ) _ulData 4 >  I _tmp_ptr Y _i L128(L129\L130L131L132L1330L134XL135L136L137.efeo47.bfe.efe "~.bfe.efeCON6CON7CON8CON9CON10CON11CON13:7.bfe.efe :~.bfe    _tmp_ptr L138H.efdeSL26dSL27|SL28SL29CON12CON14@7.bfe.efe ~.bfe _address _address   _tmp_ptr  _tmp L139LL140hL141L142.efe0*F7 .bfe .efe;$(.bfe>(L _ulData W _ulData b m  _tmp _tmp_ptr L143L1448L145lL146|L147L148.efeqCON15CON16yL70.bfe0.efe$@^.bfe*,^ _ulData   _ulData        _tmp _tmp_ptr  _i$ L149TL150L151L152L153 L1540L155dL156tL157L158L159L160.efe!R7d.bfed.efeB Xr.bfe rc n y _tmp_ptr .efLeX7x.bfex.efeL ΀.bfLeL    L     (  7 C M X d =_i@ L161L162L163L164,L165dL166L167L168.efeGCON17o^7.bfe.efe| xv.bfeM_i L169L170hL171L172,L173H.ef\e$maind7.bfe.efe_main\/0.bf\e    L174L175.efeSL30SL31$SL32PSL33tCON18CON19CON20CON21CON22CON23CON24CON25CON26CON27CON28CON29CON30CON31CON32CON33CON34CON35CON36CON37CON38CON39CON40.text 7B.data.bssj$.image.vars.cinit0w   "-8CNYdoz$CODE320w $CODE16$CODE32$CODE32 $CODE16$CODE32$CODE32\$CODE32$CODE16$CODE32$CODE32r$CODE32x$CODE16$CODE32$CODE32$CODE16$CODE32$CODE32t$CODE16$CODE32$CODE32$CODE16$CODE32$CODE32$CODE16$CODE32$CODE324$CODE16$CODE32$CODE32$CODE16$CODE32$CODE32$CODE16$CODE32$CODE32 $CODE16$CODE32$CODE32$CODE32$CODE32$CODE16$CODE32$CODE32$CODE16$CODE32$CODE32$CODE32$CODE16$CODE32$CODE32$CODE32d$CODE32$CODE16$CODE32$CODE32$CODE16$CODE32$CODE32$CODE32$CODE16$CODE32$CODE32$CODE16$CODE32$CODE32$CODE16$CODE32$CODE32L$CODE32$CODE16$CODE32$CODE32$CODE16$CODE32$CODE32\$CODE32$CODE32}gARM_MODE$ASM$  ts.bfes.ef e.textl].data.bss4k.mysect $CODE16$CODE32boot.asmg.textxU.data.bss0k.stack4k.cinitHw  $CODE32xU$CODE32Hw exit.asmg.textS .data.bss j.cinitv $$CODE32v $CODE32v $CODE32v $CODE16$CODE32$CODE32S$CODE16$CODE32$CODE32(T$CODE16$CODE32$CODE32T$CODE32Tg.text] .data.bss4k$CODE32]$CODE16,]g.text [`.data.bss4k$CODE16$CODE32$CODE32 [$CODE16$CODE32$CODE32X[$CODE16$CODE32$CODE32\[$CODE32`[g.text\$.data.bss k.cinitw  $CODE32w $CODE32$w $CODE16$CODE32$CODE32\$CODE16$CODE32$CODE32\$CODE16$CODE32$CODE32\$CODE32\@g.text7.data.bsse$.8BLV`jt~$CODE16$CODE32$CODE32$CODE16$CODE32$CODE32 $CODE16$CODE32$CODE32h!$CODE16$CODE32$CODE32"$CODE16$CODE32$CODE32#$CODE16$CODE32$CODE32&$CODE32x'$CODE16$CODE32$CODE32'$CODE32($CODE16$CODE32$CODE32($CODE16$CODE32$CODE32)$CODE32*$CODE16$CODE32$CODE32*$CODE32,$CODE16$CODE32$CODE328,$CODE16$CODE32$CODE32,$CODE16$CODE32$CODE32-$CODE16$CODE32$CODE32.$CODE32/$CODE16$CODE32$CODE32/$CODE3240$CODE16$CODE32$CODE3280$CODE32l0$CODE320atoi.asmMg.textZ.data.bss4k$CODE16$CODE32$CODE32Z$CODE32ZWg.textl].data.bss4k.const4s $CODE324s defs.asmbg.textl].data.bssat.cinit8t D$CODE328t $CODE32pv ecvt.asmpg.textC(.data.bssjd$CODE16$CODE32$CODE32C$CODE32E$CODE32Ffcvt.asm~g.textF .data.bssf$CODE16$CODE32$CODE32F$CODE32H$CODE324Hg.text8H.data.bss4k$CODE328Hg.textW.data.bss4k$CODE32W g.textJ.data.bss4k$CODE32J g.textN(.data.bss4k$CODE32N& g.textl[\.data.bss4k$CODE32l[3 g.text$CODE16$CODE32$CODE32 ?$CODE16$CODE32$CODE32?$CODE16$CODE32$CODE32(@$CODE16$CODE32$CODE32@$CODE16$CODE32$CODE32@$CODE32XA g.textW.data.bssl]   $CODE16$CODE32$CODE32W$CODE16$CODE32$CODE32X$CODE32\X $g.textT.data.bss4k$CODE32T 5g.textP .data.bss4k  $CODE16$CODE32$CODE32P$CODE16$CODE32$CODE32\Q Gg.textR.data.bss4k  $CODE16$CODE32$CODE32R$CODE16$CODE32$CODE32PS$CODE32S Sg.textZt.data.bss4k $CODE16$CODE32$CODE32Z [g.textQ.data.bss4k$CODE32Q$ hg.textO .data.bss4k0 $CODE16$CODE32$CODE32O$CODE32P: g.texthA .data.bss4kD N X b l $CODE16$CODE32$CODE32hA$CODE16$CODE32$CODE32A$CODE16$CODE32$CODE32A$CODE16$CODE32$CODE320B$CODE16$CODE32$CODE32C$CODE32Cv g.textX.data.bss4k $CODE16$CODE32$CODE32X$CODE32Y g.texth].data.bss4k $CODE16$CODE32$CODE32h]$$fake0    @ _Size` .eosf        +  D  `  y         9 T o       7 Q n     .eos f _ULONG  _USHORT  _vHwdptr  _Hwd _c_int00xU_printf [IND_CALL] j k 7k Ok e k }k k k _image _gp_varsk 0k__stack4kpinitcinit8t _exitS_atexit(Tj j_abortT$atexit$abortC$$EXIT T$exit__lock k__unlock$k$printf_fputcHV_fputsK__ftablea%\5$_nopE\__nop\WiFD_MULNU_DIVT_strncpy[_malloc7_memccpy|\_ecvtC_fcvtF_atoiZ_free9_memsetdX_strcpy0]_strlenL]FD_CMPWFD_DIVJ$atois4s __ft_endd}c$ecvtI_TOFD\_ltoaYFD_TOIl[FD_SUB8H$fcvtFD_ADDDH_putchar@V_putc$ltoaI_DIVQI_MODQ$memccpy$memchr$realloc$calloc,;(k$free_minit<7_reallocd8$minit,$malloc_calloc(86Xw $strchr$strcmp$strcpy$strlen$strncpyCQ@_getenv(@[e@p$getenvzW_readmsgXl]C$$IO$$X$readmsgU_MODT__rd_okP$_wrt_ok$_rd_ok_setvbufO_fseekZ$fflush_fflushR$fseek$setvbufC_fopenhA$fopen_freopenA$freopen_fcloseX$fclose_removeh]$remove.text  etextl]l].dataedata#.bssl]___bss__l]end4k___end__4k.8t 9DFlashWriterNOR.c$printinfo_printinfo_destAddr_destAddr$printNORflashtype_printNORflashtype_flash_id_flash_id$IdentifyNORFlash_IdentifyNORFlash_flash_id$EraseNORFlash_EraseNORFlash_flash_id_flash_id_block_size_addr_sans_cs$INTEL_Flash_Erase_Block_INTEL_Flash_Erase_Block$Enable_Flash_WP_Enable_Flash_WP_nMIFConfReg_pMIFConfReg$Disable_Flash_WP_Disable_Flash_WP_nMIFConfReg_pMIFConfReg$INTEL_Flash_Write_INTEL_Flash_Write_plAddress_plAddress_psAddress$INTEL_Soft_Reset_Flash_INTEL_Soft_Reset_Flash$AMD_Soft_Reset_Flash_AMD_Soft_Reset_Flash$INTEL_Set_Lock_Bit_INTEL_Set_Lock_Bit_plAddress_plAddress_psAddress$INTEL_Clear_Lock_Bits_INTEL_Clear_Lock_Bits_plAddress_plAddress_psAddress$INTEL_Flash_Optimized_Write_INTEL_Flash_Optimized_Write_plAddress_ullength_plAddress_ullength_psAddress_psBlockAddress_write_buffer_timeout$Flash_Do_Nothing_Flash_Do_Nothing$AMD_Flash_Erase_Block_AMD_Flash_Erase_Block_blockaddress_blockaddress_address_cs$AMD_Flash_Erase_All_AMD_Flash_Erase_All_psAddress_address_cs$AMD_Flash_Write_AMD_Flash_Write_plAddress_plAddress_psAddress_address_cs$AMD_Flash_Optimized_Write_AMD_Flash_Optimized_Write_plAddress_ullength_plAddress_ullength_psAddress_address_cs_psBlockAddress_psPollingAddress_usPollingData$AMD_Write_Buf_Abort_Reset_Flash_AMD_Write_Buf_Abort_Reset_Flash_plAddress_plAddress_address_cs$DownloadToNORFlash_DownloadToNORFlash_startWriteAddress_startReadAddress_sizeOfFile_statusAddress_flash_id_startWriteAddress_startReadAddress_sizeOfFile_statusAddress_flash_addr_flash_bc_sdram_src_flash_data_opt_array$init_OMAPHW_init_OMAPHW_flash_base_addr_nor_flash_id.text:v$0.text:v$1.text:v$2.text:v$3.text:v$4.text:v$5.text:v$6.text:v$7.text:v$8.text:v$9.text:v$10.text:v$11.text:v$12.text:v$13.text:v$14.text:v$15.text:v$16.text:v$17.text:v$18.text:v$19.text:v$20.text:v$21startup.asm.text:v$0.text:v$1.text:v$2icall32.asmprintf.asm.text:v$0.text:v$1.text:v$2_lock.asm.text:v$0.text:v$1.text:v$2_printfi.asm.text:v$0.text:v$1.text:v$2.text:v$3.text:v$4.text:v$5.text:v$6.text:v$7.text:v$8.text:v$9.text:v$10.text:v$11.text:v$12.text:v$13.text:v$14.text:v$15.text:v$0ctype.asm.text:v$0.text:v$0fd_add32.asmfd_cmp32.asmfd_div32.asmfd_mul32.asmfd_toi32.asmfputc.asm.text:v$0.text:v$1.text:v$2fputs.asm.text:v$0.text:v$1i_tofd32.asmlowlev.asm.text:v$0.text:v$1.text:v$2.text:v$3.text:v$4.text:v$5.text:v$6.text:v$7.text:v$8.text:v$9.text:v$10.text:v$11.text:v$0memccpy.asm.text:v$0memchr.asm.text:v$0memcpy32.asmmemory.asm.text:v$0.text:v$1.text:v$2.text:v$3.text:v$4.text:v$5.text:v$6.text:v$7memset32.asmstrchr.asm.text:v$0strcmp.asm.text:v$0strcpy.asm.text:v$0strlen.asm.text:v$0strncpy.asm.text:v$0sysmem.asmtrgdrv.asm.text:v$0.text:v$1.text:v$2.text:v$3.text:v$4.text:v$5.text:v$6.text:v$7.text:v$8.text:v$9trgmsg.asm.text:v$0.text:v$1u_div32.asm_io_perm.asm.text:v$0.text:v$1fflush.asm.text:v$0.text:v$1fseek.asm.text:v$0i_div32.asmsetvbuf.asm.text:v$0fopen.asm.text:v$0.text:v$1.text:v$2.text:v$3.text:v$4fclose.asm.text:v$0remove.asm.text:v$0_ReturnValue_ReadAddress_WriteAddress_NORFlashType_FLASH_NOT_FOUND_FLASH_UNSUPPORTED_FLASH_AMD_LV017_2MB_FLASH_AMD_DL800_1MB_BOTTOM_FLASH_AMD_DL800_1MB_TOP_FLASH_AMD_DL323_4MB_BOTTOM_FLASH_AMD_DL323_4MB_TOP_FLASH_AMD_LV160_2MB_BOTTOM_FLASH_AMD_LV160_2MB_TOP_FLASH_AMD_LV256M_32MB_FLASH_INTEL_BURST_8MB_BOTTOM_FLASH_INTEL_BURST_8MB_TOP_FLASH_INTEL_BURST_16MB_BOTTOM_FLASH_INTEL_BURST_16MB_TOP_FLASH_INTEL_STRATA_J3_4MB_FLASH_INTEL_STRATA_J3_8MB_FLASH_INTEL_STRATA_J3_16MB_FLASH_FUJITSU_DL323_4MB_BOTTOM_FLASH_INTEL_STRATA_K3_8MB_FLASH_INTEL_STRATA_K3_16MB_FLASH_INTEL_STRATA_K3_32MB_FLASH_MICRON_STRATA_K3_8MB_FLASH_MICRON_STRATA_K3_16MB_FLASH_INTEL_W18_16MB_TOP_FLASH_INTEL_W18_16MB_BOTTOM_FLASH_INTEL_L18_16MB_TOP_FLASH_INTEL_L18_16MB_BOTTOM_FLASH_INTEL_L18_32MB_TOP_FLASH_INTEL_L18_32MB_BOTTOM_FLASH_INTEL_K18_32MB_BOTTOM_Download_Parms_User_Hard_Reset_Flash_User_Soft_Reset_Flash_User_Flash_Erase_Block_User_Flash_Erase_All_User_Flash_Write_Entry_User_Flash_Write_User_Flash_Optimized_Write_User_Flash_Write_Exit_global_varsSTART_SRAMentrypoint_stkchk_called__STACK_SIZE__dtors_ptr__cleanup_ptr__printfi__register_lock$_register_lock__register_unlock$_register_unlock$_printfi__ctypes___tmpnams__doflush_remove_device$remove_device_add_device$add_device_HOSTclose_HOSTrename_HOSTunlink_HOSTread_HOSTopen_HOSTwrite_HOSTlseek_memalign__memory_size$memalign__sys_memory__SYSMEM_SIZE_HOSTtime$HOSTopen_HOSTclock$HOSTtime$HOSTrename$HOSTwrite$HOSTlseek$HOSTunlink$HOSTclock$HOSTclose$HOSTread_writemsg__CIOBUF_$writemsg$_doflush__cleanup$_cleanup___text_____etext_____data_____edata_____cinit_____pinit__